PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g062960.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 206aa    MW: 24131.2 Da    PI: 6.5242
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g062960.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.23.7e-2048100456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++++++eq++ Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Sopim02g062960.0.1  48 KRKLSDEQVNLLEQSFEHEHKLESERKDRLASELGLDPRQVAVWFQNRRARWK 100
                         45899***********************************************9 PP

2HD-ZIP_I/II119.71.5e-3847137292
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +kr+ls+eqv+lLE+sFe+e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++++   +++rLe+ev +L+e++ 
  Sopim02g062960.0.1  47 RKRKLSDEQVNLLEQSFEHEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKSKKLEEEYSKLKNEHETNIVDKCRLENEVLKLKEQMC 137
                         8**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.15142102IPR001356Homeobox domain
SMARTSM003892.3E-2045106IPR001356Homeobox domain
SuperFamilySSF466891.3E-1848111IPR009057Homeodomain-like
PfamPF000462.5E-1748100IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-2149109IPR009057Homeodomain-like
CDDcd000861.91E-1751103No hitNo description
PRINTSPR000311.3E-57382IPR000047Helix-turn-helix motif
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
PRINTSPR000311.3E-58298IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MNNDDQMLHI SQYYSGIYTQ QGEGKARRRR KKNKGDDVNG AMMMMMRKRK LSDEQVNLLE  60
QSFEHEHKLE SERKDRLASE LGLDPRQVAV WFQNRRARWK SKKLEEEYSK LKNEHETNIV  120
DKCRLENEVL KLKEQMCEAE KEIQRLLTER SDGVSINSPT TSSLSMEAAM DPPFLGEFGF  180
DNSFYGPGHD GMEWVNNLYN MPYHM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12949RKKNKGDDVNGAMMMMMRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233508.11e-154PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotQ9ZU706e-70ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLK4B6I41e-154K4B6I4_SOLLC; Uncharacterized protein
STRINGSolyc02g062960.2.11e-153(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.17e-57homeobox protein 21